PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 348aa    MW: 39138.3 Da    PI: 6.657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34624.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
       KHN34624.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLSRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding45.61.6e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       KHN34624.1  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.054965IPR017930Myb domain
SuperFamilySSF466893.38E-3111108IPR009057Homeodomain-like
SMARTSM007174.9E-151363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001676.03E-111661No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.7566116IPR017930Myb domain
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002496.2E-1367112IPR001005SANT/Myb domain
CDDcd001678.19E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLSRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKKFQ  120
AALDPHSASD STASGQFLPK SFSDRRSLDI SSSNNNHGSS IRLSHQSQSS STTYASSTEN  180
ISRLLEGWMR SSPKPLKGSS SQDDEDIQLQ GINDDDKNNN NFESTTKLVN LHHLQHKVRN  240
KDEHQEGGGG GVDNMVSHEE FDSILSFENL NNAAWDKSTC DSMPEKSSEA AAEYFVDHHH  300
DIAAHERNNI RQKSENSGAP PLSFLEKWLL DESVGHQVEE MMELSPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1353151e-152BT135315.1 Lotus japonicus clone JCVI-FLLj-18D4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554062.10.0PREDICTED: myb-related protein 306
SwissprotP813922e-86MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2RQR50.0A0A0B2RQR5_GLYSO; Myb-related protein 306
STRINGGLYMA19G29750.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-92myb domain protein 60
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]